SCOPe 2.05: Domain d1fiuc_: 1fiu C:

Lineage for d1fiuc_ (1fiu C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.10: Restriction endonuclease NgoIV [53008] (1 protein)
   automatically mapped to Pfam PF09015

6. Protein Restriction endonuclease NgoIV [53009] (1 species)

7. Species Neisseria gonorrhoeae [TaxId:485] [53010] (1 PDB entry)

8. Domain d1fiuc_: 1fiu C: [33319]
   protein/DNA complex; complexed with acy, mg

Details for d1fiuc_

PDB Entry: 1fiu, 1.6 Å

PDB Description: tetrameric restriction endonuclease ngomiv in complex with cleaved dna

PDB Compounds: (C:) type II restriction enzyme ngomi

SCOPe Domain Sequences for d1fiuc_:

Sequence; same for both SEQRES and ATOM records:

>d1fiuc_ c.52.1.10 (C:) Restriction endonuclease NgoIV {Neisseria gonorrhoeae [TaxId: 485]}
mqplftqerrifhkklldgnilatnnrgvvsnadgsntrsfniakgiadllhsetvserl
pgqtsgnafeaicsefvqsafeklqhirpgdwnvkqvgsrnrleiaryqqyahltalaka
aeenpelaaalgsdytitpdiivtrnliadaeinrneflvdeniatyaslragngnmpll
hasisckwtirsdraqnarseglnlvrnrkgrlphivvvtaeptpsrissialgtgeidc
vyhfalyeleqilqslnyedaldlfyimvngkrlkdisdlpldlav

Timeline for d1fiuc_:

• d1fiuc_ first appeared (with stable ids) in SCOP 1.55
  
• d1fiuc_ appears in SCOPe 2.04
  
• d1fiuc_ appears in SCOPe 2.06
  
• d1fiuc_ appears in the current release, SCOPe 2.08