Lineage for d5ihra1 (5ihr A:41-393)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832418Species Aspergillus niger [TaxId:425011] [333178] (6 PDB entries)
  8. 2832423Domain d5ihra1: 5ihr A:41-393 [333180]
    Other proteins in same PDB: d5ihra2, d5ihra3, d5ihra4, d5ihra5, d5ihra6
    automated match to d1tg7a5
    complexed with cl, dms, nag, so4

Details for d5ihra1

PDB Entry: 5ihr (more details), 2.4 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with allolactose
PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5ihra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihra1 c.1.8.0 (A:41-393) automated matches {Aspergillus niger [TaxId: 425011]}
llqkyvtwddkslfingerimifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwa
lvegkpgeyradgifdlepffdaaseagiyllarpgpyinaessgggfpgwlqrvngtlr
ssdkayldatdnyvshvaatiakyqitnggpiilyqpeneytsgccgvefpdpvymqyve
dqarnagvviplinndasasgnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptn
frtlhleqspttpyaivqfqggsydpwggpgfaacsellnnefervfykndfsfqiaimn
lymifggtnwgnlgypngytsydygsavtesrnitrekyselkllgnfakvsp

SCOPe Domain Coordinates for d5ihra1:

Click to download the PDB-style file with coordinates for d5ihra1.
(The format of our PDB-style files is described here.)

Timeline for d5ihra1: