Lineage for d5ihra4 (5ihr A:664-845)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2774984Species Aspergillus niger [TaxId:425011] [333185] (6 PDB entries)
  8. 2774993Domain d5ihra4: 5ihr A:664-845 [333186]
    Other proteins in same PDB: d5ihra1, d5ihra2, d5ihra3, d5ihra6
    automated match to d1tg7a2
    complexed with cl, dms, nag, so4

Details for d5ihra4

PDB Entry: 5ihr (more details), 2.4 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with allolactose
PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5ihra4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihra4 b.18.1.0 (A:664-845) automated matches {Aspergillus niger [TaxId: 425011]}
apdislpslkdldwkyvdtlpeiqssyddslwpaadlkqtkntlrslttptslyssdygf
htgyllyrghftatgnestfaidtqggsafgssvwlngtylgswtglyansdynatynlp
qlqagktyvitvvidnmgleenwtvgedlmktprgilnfllagrpssaiswkltgnlgge
dy

SCOPe Domain Coordinates for d5ihra4:

Click to download the PDB-style file with coordinates for d5ihra4.
(The format of our PDB-style files is described here.)

Timeline for d5ihra4: