Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Aspergillus niger [TaxId:425011] [333185] (6 PDB entries) |
Domain d5ihra5: 5ihr A:846-1007 [333187] Other proteins in same PDB: d5ihra1, d5ihra2, d5ihra3, d5ihra6 automated match to d1tg7a3 complexed with cl, dms, nag, so4 |
PDB Entry: 5ihr (more details), 2.4 Å
SCOPe Domain Sequences for d5ihra5:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ihra5 b.18.1.0 (A:846-1007) automated matches {Aspergillus niger [TaxId: 425011]} edkvrgplnegglyaerqgfhqpeppsqnwkssspleglseagigfysasfdldlpkgwd vplflnignsttpspyrvqvyvngyqyakyisnigpqtsfpvpegilnyrgtnwlavtlw aldsaggkleslelsyttpvltalgevesvdqpkykkrkgay
Timeline for d5ihra5: