Lineage for d5j5ea2 (5j5e A:615-941)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333253Family a.118.1.26: ERAP1 C-terminal-like [254170] (3 protein domains)
    Pfam PF11838; PubMed 15893768
  6. 2333263Protein automated matches [254720] (1 species)
    not a true protein
  7. 2333264Species Human (Homo sapiens) [TaxId:9606] [256059] (2 PDB entries)
  8. 2333266Domain d5j5ea2: 5j5e A:615-941 [333161]
    Other proteins in same PDB: d5j5ea1, d5j5ea3
    automated match to d3rjoa2

Details for d5j5ea2

PDB Entry: 5j5e (more details), 2.8 Å

PDB Description: crystal structure of antigen-erap1 domain complex
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d5j5ea2:

Sequence, based on SEQRES records: (download)

>d5j5ea2 a.118.1.26 (A:615-941) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgwdsltgllkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvf
qglnelipmyklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllll
acvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfsls
steksqiefalcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflr
knwnklvqkfelgsssiahmvmgttnqfstrtrleevkgffsslkengsqlrcvqqtiet
ieenigwmdknfdkirvwlqseklerm

Sequence, based on observed residues (ATOM records): (download)

>d5j5ea2 a.118.1.26 (A:615-941) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgwdsltgllkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvf
qglnelipmyklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllll
acvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfsls
steksqiefalcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflr
knwnklvqkfelgsssiahmvmgttnqfstrtrleevkgffsslkensqlrcvqqtieti
eenigwmdknfdkirvwlqseklerm

SCOPe Domain Coordinates for d5j5ea2:

Click to download the PDB-style file with coordinates for d5j5ea2.
(The format of our PDB-style files is described here.)

Timeline for d5j5ea2: