Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries) |
Domain d5j5ea1: 5j5e A:529-614 [333160] Other proteins in same PDB: d5j5ea2, d5j5ea3 automated match to d3rjoa1 |
PDB Entry: 5j5e (more details), 2.8 Å
SCOPe Domain Sequences for d5j5ea1:
Sequence, based on SEQRES records: (download)
>d5j5ea1 b.1.30.0 (A:529-614) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdv lilpeevewikfnvgmngyyivhyed
>d5j5ea1 b.1.30.0 (A:529-614) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfplititvrgrnvhmkqehymylwhvpltfitsksdmvhrfllktktdvlilpeevewi kfnvgmngyyivhyed
Timeline for d5j5ea1: