Lineage for d5j5ea1 (5j5e A:529-614)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766995Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2766996Protein automated matches [254707] (4 species)
    not a true protein
  7. 2766997Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2767016Domain d5j5ea1: 5j5e A:529-614 [333160]
    Other proteins in same PDB: d5j5ea2, d5j5ea3
    automated match to d3rjoa1

Details for d5j5ea1

PDB Entry: 5j5e (more details), 2.8 Å

PDB Description: crystal structure of antigen-erap1 domain complex
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d5j5ea1:

Sequence, based on SEQRES records: (download)

>d5j5ea1 b.1.30.0 (A:529-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdv
lilpeevewikfnvgmngyyivhyed

Sequence, based on observed residues (ATOM records): (download)

>d5j5ea1 b.1.30.0 (A:529-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfplititvrgrnvhmkqehymylwhvpltfitsksdmvhrfllktktdvlilpeevewi
kfnvgmngyyivhyed

SCOPe Domain Coordinates for d5j5ea1:

Click to download the PDB-style file with coordinates for d5j5ea1.
(The format of our PDB-style files is described here.)

Timeline for d5j5ea1: