![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) ![]() |
![]() | Family c.52.1.5: Restriction endonuclease BglII [52993] (1 protein) |
![]() | Protein Restriction endonuclease BglII [52994] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [52995] (3 PDB entries) |
![]() | Domain d1dfma_: 1dfm A: [33295] protein/DNA complex; complexed with ca |
PDB Entry: 1dfm (more details), 1.5 Å
SCOPe Domain Sequences for d1dfma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfma_ c.52.1.5 (A:) Restriction endonuclease BglII {Bacillus subtilis [TaxId: 1423]} mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty
Timeline for d1dfma_: