Lineage for d1b96b_ (1b96 B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) 
Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein) Protein Restriction endonuclease EcoRV [52985] (1 species) Species Escherichia coli [TaxId:562] [52986] (23 PDB entries) 
Domain d1b96b_: 1b96 B: [33269]
Details for d1b96b_
PDB Entry: 1b96 (more details), 2.3 Å
PDB Description: analysis of a mutational hot-spot in the ecorv restriction endonuclease: a catalytic role for a main chain carbonyl group
SCOP Domain Sequences for d1b96b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b96b_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqenhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk
SCOP Domain Coordinates for d1b96b_:
Click to download the PDB-style file with coordinates for d1b96b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b96b_:
- d1b96b_ appears in SCOP 1.57
- d1b96b_ appears in the current release, SCOPe 2.08
View in 3D
