Lineage for d1bgba_ (1bgb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121148Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2121149Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2121150Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2121171Domain d1bgba_: 1bgb A: [33254]
    protein/DNA complex

Details for d1bgba_

PDB Entry: 1bgb (more details), 2 Å

PDB Description: ecorv endonuclease complex with 5'-cgggatatccc dna
PDB Compounds: (A:) ecorv endonuclease

SCOPe Domain Sequences for d1bgba_:

Sequence, based on SEQRES records: (download)

>d1bgba_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Sequence, based on observed residues (ATOM records): (download)

>d1bgba_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvktyninelneipkpykgvkvflqdkwviagdlagsgnttn
igsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk

SCOPe Domain Coordinates for d1bgba_:

Click to download the PDB-style file with coordinates for d1bgba_.
(The format of our PDB-style files is described here.)

Timeline for d1bgba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bgbb_