PDB entry 1bgb

View 1bgb on RCSB PDB site
Description: ecorv endonuclease complex with 5'-cgggatatccc DNA
Class: hydrolase/DNA
Keywords: complex (endonuclease/DNA), hydrolase/DNA complex
Deposited on 1998-05-28, released 1998-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ecorv endonuclease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bgba_
  • Chain 'B':
    Compound: ecorv endonuclease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bgbb_
  • Chain 'C':
    Compound: DNA (5'-d(*cp*gp*gp*gp*ap*tp*ap*tp*cp*cp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*cp*gp*gp*gp*ap*tp*ap*tp*cp*cp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bgbA (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgbA (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvktyninelneipkpykgvkvflqdkwviagdlagsgnttn
    igsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bgbB (B:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgbB (B:)
    slrsdlinaldvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgyiveepkq
    qnhypdftlykpsepnkkiaidikttytnkikftlggytsfirnntknivypfdqyiahw
    iigyvytrvslktyninelneipkpykgvkvflqdkwviagdlagsgnttnigsihahyk
    dfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.