SCOPe 2.08: Domain d5f0gb1: 5f0g B:1-84

Lineage for d5f0gb1 (5f0g B:1-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (18 PDB entries)

8. Domain d5f0gb1: 5f0g B:1-84 [332530]
   Other proteins in same PDB: d5f0ga2, d5f0gb2
   automated match to d3vk9a1
   complexed with k, na

Details for d5f0gb1

PDB Entry: 5f0g, 1.6 Å

PDB Description: structure of the glutathione transferase delta 2 from drosophila melanogaster

PDB Compounds: (B:) Glutathione S-transferase D2

SCOPe Domain Sequences for d5f0gb1:

Sequence; same for both SEQRES and ATOM records:

>d5f0gb1 c.47.1.0 (B:1-84) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mdfyympggggcrtvimvakalglelnkkllntmegeqlkpefvklnpqhtiptlvdngf
siwesraiavylvekygkddyllp

Timeline for d5f0gb1:

• d5f0gb1 first appeared in SCOPe 2.06
  
• d5f0gb1 appears in SCOPe 2.07