Lineage for d5f0gb2 (5f0g B:85-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713957Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (17 PDB entries)
  8. 2713980Domain d5f0gb2: 5f0g B:85-208 [332534]
    Other proteins in same PDB: d5f0ga1, d5f0gb1
    automated match to d3vk9c2
    complexed with k, na

Details for d5f0gb2

PDB Entry: 5f0g (more details), 1.6 Å

PDB Description: structure of the glutathione transferase delta 2 from drosophila melanogaster
PDB Compounds: (B:) Glutathione S-transferase D2

SCOPe Domain Sequences for d5f0gb2:

Sequence, based on SEQRES records: (download)

>d5f0gb2 a.45.1.0 (B:85-208) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ndpkkravinqrlyfdmgtlyesfakyyyplfrtgkpgsdedlkrietafgfldtflegq
eyvagdqltvadiailstvstfevsefdfskysnvsrwydnakkvtpgwdenweglmamk
alfd

Sequence, based on observed residues (ATOM records): (download)

>d5f0gb2 a.45.1.0 (B:85-208) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ndpkkravinqrlyfdmgtlyesfakyyyplgsdedlkrietafgfldtflegqeyvagd
qltvadiailstvstfevsefdfskysnvsrwydnakkvtpgwdenweglmamkalfd

SCOPe Domain Coordinates for d5f0gb2:

Click to download the PDB-style file with coordinates for d5f0gb2.
(The format of our PDB-style files is described here.)

Timeline for d5f0gb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f0gb1