![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
![]() | Protein automated matches [191113] (9 species) not a true protein |
![]() | Species Ruminiclostridium thermocellum [TaxId:1138384] [332524] (1 PDB entry) |
![]() | Domain d5g5da_: 5g5d A: [332528] Other proteins in same PDB: d5g5db1, d5g5db2 automated match to d4fl4b_ complexed with ca |
PDB Entry: 5g5d (more details), 3 Å
SCOPe Domain Sequences for d5g5da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g5da_ b.2.2.0 (A:) automated matches {Ruminiclostridium thermocellum [TaxId: 1138384]} ahialeldktkvkvgdvivatvkaknmtsmagiqvnikydpevlqaidpatgkpftketl lvdpellsnreynplltavndinsgiinyascyvywdsyresgvsestgiigkvgfkvlk aanttvkleetrftpnsidgtlvidwygqqivgykviqpd
Timeline for d5g5da_: