SCOPe 2.06: Domain d5g5da_: 5g5d A:

Lineage for d5g5da_ (5g5d A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (9 species)
   not a true protein

7. Species Ruminiclostridium thermocellum [TaxId:1138384] [332524] (1 PDB entry)

8. Domain d5g5da_: 5g5d A: [332528]
   Other proteins in same PDB: d5g5db1, d5g5db2
   automated match to d4fl4b_
   complexed with ca

Details for d5g5da_

PDB Entry: 5g5d, 3 Å

PDB Description: crystal structure of the cohscac2-xdoccipa type ii complex from clostridium thermocellum

PDB Compounds: (A:) Cellulosome anchoring protein cohesin region

SCOPe Domain Sequences for d5g5da_:

Sequence; same for both SEQRES and ATOM records:

>d5g5da_ b.2.2.0 (A:) automated matches {Ruminiclostridium thermocellum [TaxId: 1138384]}
ahialeldktkvkvgdvivatvkaknmtsmagiqvnikydpevlqaidpatgkpftketl
lvdpellsnreynplltavndinsgiinyascyvywdsyresgvsestgiigkvgfkvlk
aanttvkleetrftpnsidgtlvidwygqqivgykviqpd

Timeline for d5g5da_:

• d5g5da_ is new in SCOPe 2.06-stable
  
• d5g5da_ appears in SCOPe 2.07
  
• d5g5da_ appears in the current release, SCOPe 2.08