Class b: All beta proteins [48724] (177 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) |
Family b.3.2.2: Pre-dockerin domain [141082] (2 proteins) PfamB PB085396 |
Protein automated matches [332607] (1 species) not a true protein |
Species Clostridium thermocellum [TaxId:203119] [332608] (1 PDB entry) |
Domain d5g5db1: 5g5d B:8-103 [332609] Other proteins in same PDB: d5g5da_, d5g5db2 automated match to d2b59b2 complexed with ca |
PDB Entry: 5g5d (more details), 3 Å
SCOPe Domain Sequences for d5g5db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g5db1 b.3.2.2 (B:8-103) automated matches {Clostridium thermocellum [TaxId: 203119]} gykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpanasgytlk isratyldrvianvvvtgdtsvstsqapimmwvgki
Timeline for d5g5db1: