Lineage for d5g5db2 (5g5d B:104-163)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016921Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2016922Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2016940Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2016941Protein automated matches [190928] (7 species)
    not a true protein
  7. 2016962Species Clostridium thermocellum [TaxId:203119] [194257] (4 PDB entries)
  8. 2016967Domain d5g5db2: 5g5d B:104-163 [332610]
    Other proteins in same PDB: d5g5da_, d5g5db1
    automated match to d2b59b1
    complexed with ca

Details for d5g5db2

PDB Entry: 5g5d (more details), 3 Å

PDB Description: crystal structure of the cohscac2-xdoccipa type ii complex from clostridium thermocellum
PDB Compounds: (B:) Cellulosomal-scaffolding protein A

SCOPe Domain Sequences for d5g5db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5db2 a.139.1.0 (B:104-163) automated matches {Clostridium thermocellum [TaxId: 203119]}
vkdnsinlldvaevircfnatkgsanyveeldinrngainmqdimivhkhfgatssdyda

SCOPe Domain Coordinates for d5g5db2:

Click to download the PDB-style file with coordinates for d5g5db2.
(The format of our PDB-style files is described here.)

Timeline for d5g5db2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g5db1
View in 3D
Domains from other chains:
(mouse over for more information)
d5g5da_