Lineage for d1az0b_ (1az0 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24772Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 24773Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) (S)
  5. 24786Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
  6. 24787Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 24788Species Escherichia coli [TaxId:562] [52986] (23 PDB entries)
  8. Domain d1az0b_: 1az0 B: [33249]

Details for d1az0b_

PDB Entry: 1az0 (more details), 2 Å

PDB Description: ecorv endonuclease/dna complex

SCOP Domain Sequences for d1az0b_:

Sequence, based on SEQRES records: (download)

>d1az0b_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Sequence, based on observed residues (ATOM records): (download)

>d1az0b_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydedvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgyivee
pkqqnhypdftlykpsepnkkiaidikttytnikftlggytsfirnntknivypfdqyia
hwiigyvytrvslktynielneipkpykgvkvflqdkwviagdlagsgnttnigsihahy
kdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk

SCOP Domain Coordinates for d1az0b_ are not available.

Timeline for d1az0b_:

Domains from other chains:
(mouse over for more information)
d1az0a_