Lineage for d1eo4a_ (1eo4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121148Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2121149Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2121150Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2121165Domain d1eo4a_: 1eo4 A: [33246]
    protein/DNA complex; complexed with acy, mn

Details for d1eo4a_

PDB Entry: 1eo4 (more details), 1.9 Å

PDB Description: ecorv bound to mn2+ and cognate dna containing a 3's substition at the cleavage site
PDB Compounds: (A:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d1eo4a_:

Sequence, based on SEQRES records: (download)

>d1eo4a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Sequence, based on observed residues (ATOM records): (download)

>d1eo4a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvksslktynilneipkpykgvkvflqdkwviagdlagsgnt
tnigsihahykdfvegkgifdsedefldywrnyertsqrndkynniseyrnwiyrgrk

SCOPe Domain Coordinates for d1eo4a_:

Click to download the PDB-style file with coordinates for d1eo4a_.
(The format of our PDB-style files is described here.)

Timeline for d1eo4a_: