Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
Protein automated matches [190971] (12 species) not a true protein |
Species Streptomyces griseoflavus [TaxId:35619] [332372] (1 PDB entry) |
Domain d5ivub_: 5ivu B: [332373] automated match to d1tvja_ |
PDB Entry: 5ivu (more details), 2.42 Å
SCOPe Domain Sequences for d5ivub_:
Sequence, based on SEQRES records: (download)
>d5ivub_ d.109.1.0 (B:) automated matches {Streptomyces griseoflavus [TaxId: 35619]} gvtlndacvetyqqlklgkklkyiifhlnkenteiavekssdsvdydnfladlpedecrw avydleyekeegagkrnkltfvswapdsakmkqkmayasskdilrraltgiaveiqgtdf sevahenvldkasrgh
>d5ivub_ d.109.1.0 (B:) automated matches {Streptomyces griseoflavus [TaxId: 35619]} gvtlndacvetyqqlklgkklkyiifhlnkenteiavekssdsvdydnfladlpedecrw avydleyeagkrnkltfvswapdsakmkqkmayasskdilrraltgiaveiqgtdfseva henvldkasrgh
Timeline for d5ivub_: