SCOPe 2.08: Domain d5ivub_: 5ivu B:

Lineage for d5ivub_ (5ivu B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.0: automated matches [191561] (1 protein)
   not a true family

6. Protein automated matches [190971] (14 species)
   not a true protein

7. Species Streptomyces griseoflavus [TaxId:35619] [332372] (1 PDB entry)

8. Domain d5ivub_: 5ivu B: [332373]
   automated match to d1tvja_

Details for d5ivub_

PDB Entry: 5ivu, 2.42 Å

PDB Description: crystal structure of streptomyces griseoflavus cofilin

PDB Compounds: (B:) cofilin

SCOPe Domain Sequences for d5ivub_:

Sequence, based on SEQRES records:

>d5ivub_ d.109.1.0 (B:) automated matches {Streptomyces griseoflavus [TaxId: 35619]}
gvtlndacvetyqqlklgkklkyiifhlnkenteiavekssdsvdydnfladlpedecrw
avydleyekeegagkrnkltfvswapdsakmkqkmayasskdilrraltgiaveiqgtdf
sevahenvldkasrgh

Sequence, based on observed residues (ATOM records):

>d5ivub_ d.109.1.0 (B:) automated matches {Streptomyces griseoflavus [TaxId: 35619]}
gvtlndacvetyqqlklgkklkyiifhlnkenteiavekssdsvdydnfladlpedecrw
avydleyeagkrnkltfvswapdsakmkqkmayasskdilrraltgiaveiqgtdfseva
henvldkasrgh

Timeline for d5ivub_:

• d5ivub_ first appeared in SCOPe 2.06
  
• d5ivub_ appears in SCOPe 2.07