| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) ![]() |
| Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein) contains additional structures in the C-terminal extension |
| Protein Diol dehydratase, beta subunit [52970] (2 species) |
| Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries) |
| Domain d1eexb_: 1eex B: [33213] Other proteins in same PDB: d1eexa_, d1eexg_, d1eexl_, d1eexm_ complexed with coy, k, pgo |
PDB Entry: 1eex (more details), 1.7 Å
SCOPe Domain Sequences for d1eexb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eexb_ c.51.3.1 (B:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva
Timeline for d1eexb_: