PDB entry 1eex

View 1eex on RCSB PDB site
Description: crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsiella oxytoca
Class: lyase
Keywords: coenzyme b12, propanediol, potassium ion, tim barrel, lyase
Deposited on 2000-02-04, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eexa_
  • Chain 'B':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eexb_
  • Chain 'E':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eexe_
  • Chain 'G':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eexg_
  • Chain 'L':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eexl_
  • Chain 'M':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eexm_
  • Heterogens: K, COY, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eexA (A:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpneid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eexA (A:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eexB (B:)
    meinekllrqiiedvlsemkgsdkpvsfnapaasaapqatppagdgfltevgearqgtqq
    deviiavgpafglaqtvnivgiphksilreviagieeegikarvircfkssdvafvaveg
    nrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyrqigknaaryakres
    pqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eexB (B:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1eexE (E:)
    meinekllrqiiedvlsemkgsdkpvsfnapaasaapqatppagdgfltevgearqgtqq
    deviiavgpafglaqtvnivgiphksilreviagieeegikarvircfkssdvafvaveg
    nrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyrqigknaaryakres
    pqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eexE (E:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1eexG (G:)
    mntdaiesmvrdvlsrmnslqgeapaaapaaggasrsarvsdyplankhpewvktatnkt
    lddftlenvlsnkvtaqdmritpetlrlqasiakdagrdrlamnferaaeltavpddril
    eiynalrpyrstkeellaiaddlesryqakicaafvreaatlyverkklkgdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eexG (G:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1eexL (L:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpneid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eexL (L:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1eexM (M:)
    mntdaiesmvrdvlsrmnslqgeapaaapaaggasrsarvsdyplankhpewvktatnkt
    lddftlenvlsnkvtaqdmritpetlrlqasiakdagrdrlamnferaaeltavpddril
    eiynalrpyrstkeellaiaddlesryqakicaafvreaatlyverkklkgdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eexM (M:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd