Lineage for d1eexb_ (1eex B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 
Superfamily c.51.3: Diol dehydratase, beta subunit [52968] (1 family) 
Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein) Protein Diol dehydratase, beta subunit [52970] (1 species) Species Klebsiella oxytoca [TaxId:571] [52971] (4 PDB entries) 
Domain d1eexb_: 1eex B: [33213]
Other proteins in same PDB: d1eexa_, d1eexg_, d1eexl_, d1eexm_
Details for d1eexb_
PDB Entry: 1eex (more details), 1.7 Å
PDB Description: crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsiella oxytoca
SCOP Domain Sequences for d1eexb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eexb_ c.51.3.1 (B:) Diol dehydratase, beta subunit {Klebsiella oxytoca}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva
SCOP Domain Coordinates for d1eexb_:
Click to download the PDB-style file with coordinates for d1eexb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eexb_:
- d1eexb_ appears in SCOP 1.57
- d1eexb_ appears in the current release, SCOPe 2.08
View in 3D
