SCOPe 2.08: Domain d1eexg_: 1eex G:

Lineage for d1eexg_ (1eex G:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family)
   contains irregular N-terminal subdomain
   automatically mapped to Pfam PF02287

5. Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins)

6. Protein Diol dehydratase, gamma subunit [47150] (2 species)

7. Species Klebsiella oxytoca [TaxId:571] [47151] (8 PDB entries)

8. Domain d1eexg_: 1eex G: [16490]
   Other proteins in same PDB: d1eexa_, d1eexb_, d1eexe_, d1eexl_
   complexed with coy, k, pgo

Details for d1eexg_

PDB Entry: 1eex, 1.7 Å

PDB Description: crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsiella oxytoca

PDB Compounds: (G:) propanediol dehydratase

SCOPe Domain Sequences for d1eexg_:

Sequence; same for both SEQRES and ATOM records:

>d1eexg_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella oxytoca [TaxId: 571]}
sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
reaatlyverkklkgdd

Timeline for d1eexg_:

• d1eexg_ first appeared (with stable ids) in SCOP 1.55
  
• d1eexg_ appears in SCOPe 2.07