Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.12: TmoB-like [110814] (2 families) possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
Family d.15.12.0: automated matches [191572] (1 protein) not a true family |
Protein automated matches [190991] (1 species) not a true protein |
Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries) |
Domain d5tdtc_: 5tdt C: [332069] Other proteins in same PDB: d5tdta_, d5tdtd_, d5tdte_, d5tdth_ automated match to d3q14c_ complexed with fe, mbn, per |
PDB Entry: 5tdt (more details), 1.82 Å
SCOPe Domain Sequences for d5tdtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tdtc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]} safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf prdmtiaesglnptevidvvfe
Timeline for d5tdtc_: