Lineage for d5tdtc_ (5tdt C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2935136Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2935158Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 2935159Protein automated matches [190991] (1 species)
    not a true protein
  7. 2935160Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)
  8. 2935174Domain d5tdtc_: 5tdt C: [332069]
    Other proteins in same PDB: d5tdta_, d5tdtd_, d5tdte_, d5tdth_
    automated match to d3q14c_
    complexed with fe, mbn, per

Details for d5tdtc_

PDB Entry: 5tdt (more details), 1.82 Å

PDB Description: oxygenated toluene intermediate in toluene 4-monooxygenase (t4mohd) after reaction in the crystal
PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d5tdtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdtc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

SCOPe Domain Coordinates for d5tdtc_:

Click to download the PDB-style file with coordinates for d5tdtc_.
(The format of our PDB-style files is described here.)

Timeline for d5tdtc_: