| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.12: TmoB-like [110814] (2 families) ![]() possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
| Family d.15.12.0: automated matches [191572] (1 protein) not a true family |
| Protein automated matches [190991] (1 species) not a true protein |
| Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries) |
| Domain d3q14c_: 3q14 C: [184144] Other proteins in same PDB: d3q14a_, d3q14e_ automated match to d1t0rc_ complexed with fe, pcr |
PDB Entry: 3q14 (more details), 1.75 Å
SCOPe Domain Sequences for d3q14c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q14c_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfee
Timeline for d3q14c_: