| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
| Family a.137.10.1: Stathmin [101495] (2 proteins) |
| Protein Stathmin 4 [101496] (3 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
| Domain d5gone_: 5gon E: [331617] Other proteins in same PDB: d5gona1, d5gona2, d5gonb1, d5gonb2, d5gonc1, d5gonc2, d5gond1, d5gond2, d5gonf1, d5gonf2 automated match to d4i4te_ complexed with 6zr, ca, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 5gon (more details), 2.48 Å
SCOPe Domain Sequences for d5gone_:
Sequence, based on SEQRES records: (download)
>d5gone_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke
>d5gone_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e
Timeline for d5gone_: