Lineage for d5gone_ (5gon E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346952Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2346953Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2346954Protein Stathmin 4 [101496] (3 species)
  7. 2346971Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries)
  8. 2347109Domain d5gone_: 5gon E: [331617]
    Other proteins in same PDB: d5gona1, d5gona2, d5gonb1, d5gonb2, d5gonc1, d5gonc2, d5gond1, d5gond2, d5gonf1, d5gonf2
    automated match to d4i4te_
    complexed with 6zr, ca, gdp, gol, gtp, imd, mes, mg

Details for d5gone_

PDB Entry: 5gon (more details), 2.48 Å

PDB Description: structures of a beta-lactam bridged analogue in complex with tubulin
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5gone_:

Sequence, based on SEQRES records: (download)

>d5gone_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5gone_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5gone_:

Click to download the PDB-style file with coordinates for d5gone_.
(The format of our PDB-style files is described here.)

Timeline for d5gone_: