Lineage for d5ws5z_ (5ws5 z:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252855Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2253087Superfamily f.17.5: PsbZ-like [161055] (1 family) (S)
    automatically mapped to Pfam PF01737
  5. 2253088Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 2253089Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 2253099Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (12 PDB entries)
  8. 2253108Domain d5ws5z_: 5ws5 z: [331584]
    Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5j_, d5ws5k_, d5ws5o_, d5ws5v_, d5ws5x_
    automated match to d4pj0z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5ws5z_

PDB Entry: 5ws5 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash dark dataset)
PDB Compounds: (z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5ws5z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws5z_ f.17.5.1 (z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d5ws5z_:

Click to download the PDB-style file with coordinates for d5ws5z_.
(The format of our PDB-style files is described here.)

Timeline for d5ws5z_: