Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.5: PsbZ-like [161055] (1 family) automatically mapped to Pfam PF01737 |
Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (12 PDB entries) |
Domain d5ws5z_: 5ws5 z: [331584] Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5j_, d5ws5k_, d5ws5o_, d5ws5v_, d5ws5x_ automated match to d4pj0z_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5ws5 (more details), 2.35 Å
SCOPe Domain Sequences for d5ws5z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws5z_ f.17.5.1 (z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]} mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff vv
Timeline for d5ws5z_: