Lineage for d5ws5v_ (5ws5 v:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981426Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981427Protein automated matches [190453] (22 species)
    not a true protein
  7. 1981556Species Thermosynechococcus vulcanus [TaxId:32053] [329405] (6 PDB entries)
  8. 1981560Domain d5ws5v_: 5ws5 v: [331593]
    Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5j_, d5ws5k_, d5ws5o_, d5ws5x_, d5ws5z_
    automated match to d1e29a_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5ws5v_

PDB Entry: 5ws5 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash dark dataset)
PDB Compounds: (v:) cytochrome c-550

SCOPe Domain Sequences for d5ws5v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws5v_ a.3.1.0 (v:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d5ws5v_:

Click to download the PDB-style file with coordinates for d5ws5v_.
(The format of our PDB-style files is described here.)

Timeline for d5ws5v_: