Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.5: PsbZ-like [161055] (1 family) automatically mapped to Pfam PF01737 |
Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161058] (8 PDB entries) Uniprot Q8DHJ2 1-62 |
Domain d4pj0z_: 4pj0 Z: [260556] Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_ automated match to d2axtz1 complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl |
PDB Entry: 4pj0 (more details), 2.44 Å
SCOPe Domain Sequences for d4pj0z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj0z_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]} mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff vv
Timeline for d4pj0z_: