![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d5u1rh1: 5u1r H:1-99 [331453] Other proteins in same PDB: d5u1ra1, d5u1ra2, d5u1ra3, d5u1rb1, d5u1rb2, d5u1rc1, d5u1rc2, d5u1rc3, d5u1rd1, d5u1rd2, d5u1re1, d5u1re2, d5u1rg1, d5u1rg2, d5u1rh2 automated match to d1duzb_ complexed with act, dif, gol, na |
PDB Entry: 5u1r (more details), 2.7 Å
SCOPe Domain Sequences for d5u1rh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u1rh1 b.1.1.2 (H:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d5u1rh1: