Lineage for d5u1re1 (5u1r E:2-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758637Domain d5u1re1: 5u1r E:2-116 [331420]
    Other proteins in same PDB: d5u1ra1, d5u1ra3, d5u1rb2, d5u1rc1, d5u1rc3, d5u1rd2, d5u1rf_, d5u1rh1, d5u1rh2
    automated match to d2axha1
    complexed with act, dif, gol, na

Details for d5u1re1

PDB Entry: 5u1r (more details), 2.7 Å

PDB Description: structure of human mr1-diclofenac in complex with human mait a-f7 tcr
PDB Compounds: (E:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d5u1re1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u1re1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

SCOPe Domain Coordinates for d5u1re1:

Click to download the PDB-style file with coordinates for d5u1re1.
(The format of our PDB-style files is described here.)

Timeline for d5u1re1: