| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
| Protein automated matches [226842] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
| Domain d5u1rc1: 5u1r C:1-178 [331411] Other proteins in same PDB: d5u1ra2, d5u1ra3, d5u1rb1, d5u1rb2, d5u1rc2, d5u1rc3, d5u1rd1, d5u1rd2, d5u1re1, d5u1re2, d5u1rf_, d5u1rg1, d5u1rg2, d5u1rh1, d5u1rh2 automated match to d4l4va1 complexed with act, dif, gol, na |
PDB Entry: 5u1r (more details), 2.7 Å
SCOPe Domain Sequences for d5u1rc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u1rc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d5u1rc1: