Lineage for d5u1ra1 (5u1r A:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938873Domain d5u1ra1: 5u1r A:1-178 [331510]
    Other proteins in same PDB: d5u1ra2, d5u1ra3, d5u1rb1, d5u1rb2, d5u1rc2, d5u1rc3, d5u1rd1, d5u1rd2, d5u1re1, d5u1re2, d5u1rf_, d5u1rg1, d5u1rg2, d5u1rh1, d5u1rh2
    automated match to d4l4va1
    complexed with act, dif, gol, na

Details for d5u1ra1

PDB Entry: 5u1r (more details), 2.7 Å

PDB Description: structure of human mr1-diclofenac in complex with human mait a-f7 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u1ra1:

Sequence, based on SEQRES records: (download)

>d5u1ra1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records): (download)

>d5u1ra1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpivpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwery
tqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdflif
nkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d5u1ra1:

Click to download the PDB-style file with coordinates for d5u1ra1.
(The format of our PDB-style files is described here.)

Timeline for d5u1ra1: