| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
| Protein Class phi GST [81367] (3 species) |
| Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries) |
| Domain d1byed2: 1bye D:1-80 [33029] Other proteins in same PDB: d1byea1, d1byeb1, d1byec1, d1byed1 complexed with ata |
PDB Entry: 1bye (more details), 2.8 Å
SCOPe Domain Sequences for d1byed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byed2 c.47.1.5 (D:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkp
Timeline for d1byed2: