Lineage for d1byec1 (1bye C:81-213)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089498Protein Class phi GST [81356] (3 species)
  7. 1089499Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries)
  8. 1089504Domain d1byec1: 1bye C:81-213 [17734]
    Other proteins in same PDB: d1byea2, d1byeb2, d1byec2, d1byed2
    complexed with ata

Details for d1byec1

PDB Entry: 1bye (more details), 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate
PDB Compounds: (C:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1byec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byec1 a.45.1.1 (C:81-213) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalmkpsa

SCOPe Domain Coordinates for d1byec1:

Click to download the PDB-style file with coordinates for d1byec1.
(The format of our PDB-style files is described here.)

Timeline for d1byec1: