Lineage for d1bx9a2 (1bx9 A:1-85)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992579Protein Class phi GST [81367] (3 species)
  7. 992589Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [52880] (2 PDB entries)
  8. 992592Domain d1bx9a2: 1bx9 A:1-85 [33023]
    Other proteins in same PDB: d1bx9a1

Details for d1bx9a2

PDB Entry: 1bx9 (more details), 2.6 Å

PDB Description: glutathione s-transferase in complex with herbicide
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1bx9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx9a2 c.47.1.5 (A:1-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnll

SCOPe Domain Coordinates for d1bx9a2:

Click to download the PDB-style file with coordinates for d1bx9a2.
(The format of our PDB-style files is described here.)

Timeline for d1bx9a2: