SCOPe 2.08: Domain d1bx9a2: 1bx9 A:1-85

Lineage for d1bx9a2 (1bx9 A:1-85)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class phi GST [81367] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [52880] (2 PDB entries)

8. Domain d1bx9a2: 1bx9 A:1-85 [33023]
   Other proteins in same PDB: d1bx9a1

Details for d1bx9a2

PDB Entry: 1bx9, 2.6 Å

PDB Description: glutathione s-transferase in complex with herbicide

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1bx9a2:

Sequence; same for both SEQRES and ATOM records:

>d1bx9a2 c.47.1.5 (A:1-85) Class phi GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnll

Timeline for d1bx9a2:

• d1bx9a2 first appeared (with stable ids) in SCOP 1.55
  
• d1bx9a2 appears in SCOPe 2.07