Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) |
Protein Glutathione S-transferase [52863] (22 species) |
Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [52880] (2 PDB entries) |
Domain d1bx9a2: 1bx9 A:1-85 [33023] Other proteins in same PDB: d1bx9a1 |
PDB Entry: 1bx9 (more details), 2.6 Å
SCOP Domain Sequences for d1bx9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx9a2 c.47.1.5 (A:1-85) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana)} gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd lklfesraitqyiahryenqgtnll
Timeline for d1bx9a2: