Lineage for d1bx9a2 (1bx9 A:1-85)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) Protein Glutathione S-transferase [52863] (22 species) 
Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [52880] (2 PDB entries) 
Domain d1bx9a2: 1bx9 A:1-85 [33023]
Other proteins in same PDB: d1bx9a1
Details for d1bx9a2
PDB Entry: 1bx9 (more details), 2.6 Å
PDB Description: glutathione s-transferase in complex with herbicide
SCOP Domain Sequences for d1bx9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx9a2 c.47.1.5 (A:1-85) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana)}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnll
SCOP Domain Coordinates for d1bx9a2:
Click to download the PDB-style file with coordinates for d1bx9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bx9a2:
- d1bx9a2 appears in SCOP 1.57
- d1bx9a2 appears in the current release, SCOPe 2.08
View in 3D
