| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
| Protein Class alpha GST [81360] (8 species) |
| Species Rat (Rattus norvegicus), (a1-1) [TaxId:10116] [52871] (2 PDB entries) |
| Domain d1ev4d2: 1ev4 D:2-79 [32989] Other proteins in same PDB: d1ev4a1, d1ev4c1, d1ev4d1 complexed with gts, so4; mutant |
PDB Entry: 1ev4 (more details), 2.2 Å
SCOPe Domain Sequences for d1ev4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ev4d2 c.47.1.5 (D:2-79) Class alpha GST {Rat (Rattus norvegicus), (a1-1) [TaxId: 10116]}
sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatky
Timeline for d1ev4d2:
View in 3DDomains from other chains: (mouse over for more information) d1ev4a1, d1ev4a2, d1ev4c1, d1ev4c2 |