Lineage for d1ev4d2 (1ev4 D:2-79)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168430Protein Class alpha GST [81360] (8 species)
  7. 1168520Species Rat (Rattus norvegicus), (a1-1) [TaxId:10116] [52871] (2 PDB entries)
  8. 1168523Domain d1ev4d2: 1ev4 D:2-79 [32989]
    Other proteins in same PDB: d1ev4a1, d1ev4c1, d1ev4d1
    complexed with gts, so4; mutant

Details for d1ev4d2

PDB Entry: 1ev4 (more details), 2.2 Å

PDB Description: rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound
PDB Compounds: (D:) glutathione s-transferase a1-1

SCOPe Domain Sequences for d1ev4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev4d2 c.47.1.5 (D:2-79) Class alpha GST {Rat (Rattus norvegicus), (a1-1) [TaxId: 10116]}
sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatky

SCOPe Domain Coordinates for d1ev4d2:

Click to download the PDB-style file with coordinates for d1ev4d2.
(The format of our PDB-style files is described here.)

Timeline for d1ev4d2: