![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class alpha GST [81360] (8 species) |
![]() | Species Norway rat (Rattus norvegicus), (a1-1) [TaxId:10116] [52871] (2 PDB entries) |
![]() | Domain d1ev4d2: 1ev4 D:2-79 [32989] Other proteins in same PDB: d1ev4a1, d1ev4c1, d1ev4d1 complexed with gts, so4; mutant |
PDB Entry: 1ev4 (more details), 2.2 Å
SCOPe Domain Sequences for d1ev4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ev4d2 c.47.1.5 (D:2-79) Class alpha GST {Norway rat (Rattus norvegicus), (a1-1) [TaxId: 10116]} sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid gmklaqtrailnyiatky
Timeline for d1ev4d2:
![]() Domains from other chains: (mouse over for more information) d1ev4a1, d1ev4a2, d1ev4c1, d1ev4c2 |