Lineage for d5u2vc1 (5u2v C:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938808Domain d5u2vc1: 5u2v C:1-178 [329631]
    Other proteins in same PDB: d5u2va2, d5u2va3, d5u2vb_, d5u2vc2, d5u2vc3, d5u2vd_, d5u2ve1, d5u2ve2, d5u2vf1, d5u2vf2, d5u2vg1, d5u2vg2, d5u2vh1, d5u2vh2
    automated match to d4l4va1
    complexed with 7wq, gol, pro

Details for d5u2vc1

PDB Entry: 5u2v (more details), 2.2 Å

PDB Description: structure of human mr1-hmb in complex with human mait a-f7 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u2vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u2vc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d5u2vc1:

Click to download the PDB-style file with coordinates for d5u2vc1.
(The format of our PDB-style files is described here.)

Timeline for d5u2vc1: