Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d5u2va1: 5u2v A:1-178 [329565] Other proteins in same PDB: d5u2va2, d5u2va3, d5u2vb_, d5u2vc2, d5u2vc3, d5u2vd_, d5u2ve1, d5u2ve2, d5u2vf1, d5u2vf2, d5u2vg1, d5u2vg2, d5u2vh1, d5u2vh2 automated match to d4l4va1 complexed with 7wq, gol, pro |
PDB Entry: 5u2v (more details), 2.2 Å
SCOPe Domain Sequences for d5u2va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u2va1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d5u2va1: