| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (7 species) |
| Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries) |
| Domain d5u2vg2: 5u2v G:111-199 [329621] Other proteins in same PDB: d5u2va1, d5u2va2, d5u2va3, d5u2vb_, d5u2vc1, d5u2vc2, d5u2vc3, d5u2vd_, d5u2ve1, d5u2vf1, d5u2vf2, d5u2vg1, d5u2vh1, d5u2vh2 automated match to d2f54d2 complexed with 7wq, gol, pro missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 5u2v (more details), 2.2 Å
SCOPe Domain Sequences for d5u2vg2:
Sequence, based on SEQRES records: (download)
>d5u2vg2 b.1.1.2 (G:111-199) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps
>d5u2vg2 b.1.1.2 (G:111-199) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
sndfacanafnnsiipedtffps
Timeline for d5u2vg2: