Lineage for d5u2vg2 (5u2v G:111-199)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749669Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
  8. 2749693Domain d5u2vg2: 5u2v G:111-199 [329621]
    Other proteins in same PDB: d5u2va1, d5u2va2, d5u2va3, d5u2vb_, d5u2vc1, d5u2vc2, d5u2vc3, d5u2vd_, d5u2ve1, d5u2vf1, d5u2vf2, d5u2vg1, d5u2vh1, d5u2vh2
    automated match to d2f54d2
    complexed with 7wq, gol, pro

    missing some secondary structures that made up less than one-third of the common domain

Details for d5u2vg2

PDB Entry: 5u2v (more details), 2.2 Å

PDB Description: structure of human mr1-hmb in complex with human mait a-f7 tcr
PDB Compounds: (G:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u2vg2:

Sequence, based on SEQRES records: (download)

>d5u2vg2 b.1.1.2 (G:111-199) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d5u2vg2 b.1.1.2 (G:111-199) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
sndfacanafnnsiipedtffps

SCOPe Domain Coordinates for d5u2vg2:

Click to download the PDB-style file with coordinates for d5u2vg2.
(The format of our PDB-style files is described here.)

Timeline for d5u2vg2: