SCOPe 2.08: Domain d5u2vg2: 5u2v G:111-199

Lineage for d5u2vg2 (5u2v G:111-199)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)

8. Domain d5u2vg2: 5u2v G:111-199 [329621]
   Other proteins in same PDB: d5u2va1, d5u2va2, d5u2va3, d5u2vb_, d5u2vc1, d5u2vc2, d5u2vc3, d5u2vd_, d5u2ve1, d5u2vf1, d5u2vf2, d5u2vg1, d5u2vh1, d5u2vh2
   automated match to d2f54d2
   complexed with 7wq, gol, pro
   missing some secondary structures that made up less than one-third of the common domain

Details for d5u2vg2

PDB Entry: 5u2v, 2.2 Å

PDB Description: structure of human mr1-hmb in complex with human mait a-f7 tcr

PDB Compounds: (G:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u2vg2:

Sequence, based on SEQRES records:

>d5u2vg2 b.1.1.2 (G:111-199) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d5u2vg2 b.1.1.2 (G:111-199) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
sndfacanafnnsiipedtffps

Timeline for d5u2vg2:

• d5u2vg2 first appeared in SCOPe 2.06
  
• d5u2vg2 appears in SCOPe 2.07