Details for d4l4va1

PDB Entry: 4l4v (more details), 1.9 Å

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4l4va1:

Sequence, based on SEQRES records: (download)

>d4l4va1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records): (download)

>d4l4va1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpigvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwer
ytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfli
fnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4l4va1:

Timeline for d4l4va1:

• d4l4va1 first appeared in SCOPe 2.04
  
• d4l4va1 appears in SCOPe 2.07
  

Thumbnails for d4l4va1:

d4l4va1 (click for larger image) View in 3D

d4l4va1 in context of chain d4l4va2 in context of chain View in 3D Domains from same chain: (mouse over for more information) d4l4va2

d4l4va1 in context of PDB d4l4vb_ in context of PDB d4l4vc1 in context of PDB d4l4vc2 in context of PDB d4l4vc3 in context of PDB d4l4vd1 in context of PDB d4l4vd2 in context of PDB d4l4ve1 in context of PDB d4l4ve2 in context of PDB d4l4vf_ in context of PDB d4l4vg1 in context of PDB d4l4vg2 in context of PDB d4l4vh1 in context of PDB d4l4vh2 in context of PDB View in 3D Domains from other chains: (mouse over for more information) d4l4vb_, d4l4vc1, d4l4vc2, d4l4vc3, d4l4vd1, d4l4vd2, d4l4ve1, d4l4ve2, d4l4vf_, d4l4vg1, d4l4vg2, d4l4vh1, d4l4vh2