SCOP 1.71: Domain d1gsub2: 1gsu B:1-84

Lineage for d1gsub2 (1gsu B:1-84)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (16 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [52869] (2 PDB entries)

8. Domain d1gsub2: 1gsu B:1-84 [32956]
   Other proteins in same PDB: d1gsua1, d1gsub1
   complexed with gtx

Details for d1gsub2

PDB Entry: 1gsu, 1.94 Å

PDB Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution

SCOP Domain Sequences for d1gsub2:

Sequence; same for both SEQRES and ATOM records:

>d1gsub2 c.47.1.5 (B:1-84) Class mu GST {Chicken (Gallus gallus)}
vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
ylidgdvkltqsnailryiarkhn

Timeline for d1gsub2:

• d1gsub2 first appeared (with stable ids) in SCOP 1.55
  
• d1gsub2 appears in SCOP 1.69
  
• d1gsub2 appears in SCOP 1.73
  
• d1gsub2 appears in the current release, SCOPe 2.08