Lineage for d1gsub1 (1gsu B:85-217)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538565Protein Class mu GST [81348] (3 species)
  7. 538566Species Chicken (Gallus gallus) [TaxId:9031] [47624] (2 PDB entries)
  8. 538568Domain d1gsub1: 1gsu B:85-217 [17662]
    Other proteins in same PDB: d1gsua2, d1gsub2
    complexed with gtx

Details for d1gsub1

PDB Entry: 1gsu (more details), 1.94 Å

PDB Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution

SCOP Domain Sequences for d1gsub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsub1 a.45.1.1 (B:85-217) Class mu GST {Chicken (Gallus gallus)}
mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpayleqlpgklrqlsrflgsr
swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk
apifwytalwnnk

SCOP Domain Coordinates for d1gsub1:

Click to download the PDB-style file with coordinates for d1gsub1.
(The format of our PDB-style files is described here.)

Timeline for d1gsub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsub2