Class a: All alpha proteins [46456] (226 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [47624] (2 PDB entries) |
Domain d1gsub1: 1gsu B:85-217 [17662] Other proteins in same PDB: d1gsua2, d1gsub2 complexed with gtx |
PDB Entry: 1gsu (more details), 1.94 Å
SCOP Domain Sequences for d1gsub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsub1 a.45.1.1 (B:85-217) Class mu GST {Chicken (Gallus gallus)} mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpayleqlpgklrqlsrflgsr swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk apifwytalwnnk
Timeline for d1gsub1: