Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (16 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
Protein Class mu GST [81359] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [52869] (2 PDB entries) |
Domain d1gsua2: 1gsu A:1-84 [32955] Other proteins in same PDB: d1gsua1, d1gsub1 |
PDB Entry: 1gsu (more details), 1.94 Å
SCOP Domain Sequences for d1gsua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsua2 c.47.1.5 (A:1-84) Class mu GST {Chicken (Gallus gallus)} vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp ylidgdvkltqsnailryiarkhn
Timeline for d1gsua2: