Lineage for d1gsub2 (1gsu B:1-84)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699397Protein Class mu GST [81359] (3 species)
  7. 699398Species Chicken (Gallus gallus) [TaxId:9031] [52869] (2 PDB entries)
  8. 699400Domain d1gsub2: 1gsu B:1-84 [32956]
    Other proteins in same PDB: d1gsua1, d1gsub1
    complexed with gtx

Details for d1gsub2

PDB Entry: 1gsu (more details), 1.94 Å

PDB Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution
PDB Compounds: (B:) class-mu glutathione s-transferase

SCOP Domain Sequences for d1gsub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsub2 c.47.1.5 (B:1-84) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}
vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
ylidgdvkltqsnailryiarkhn

SCOP Domain Coordinates for d1gsub2:

Click to download the PDB-style file with coordinates for d1gsub2.
(The format of our PDB-style files is described here.)

Timeline for d1gsub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsub1