SCOPe 2.08: Domain d5k3sa2: 5k3s A:281-459

Lineage for d5k3sa2 (5k3s A:281-459)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142123] (13 PDB entries)
   Uniprot P17597 281-459

8. Domain d5k3sa2: 5k3s A:281-459 [329459]
   Other proteins in same PDB: d5k3sa1, d5k3sa3, d5k3sa4
   automated match to d1ybha1
   complexed with 6ql, fad, mg, tp9

Details for d5k3sa2

PDB Entry: 5k3s, 2.87 Å

PDB Description: crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium

PDB Compounds: (A:) Acetolactate synthase, chloroplastic

SCOPe Domain Sequences for d5k3sa2:

Sequence; same for both SEQRES and ATOM records:

>d5k3sa2 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
pkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgipvastlmglgsypc
ddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafasrakivhididsae
igknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnvqkqkfplsfktfg

Timeline for d5k3sa2:

• d5k3sa2 first appeared in SCOPe 2.06
  
• d5k3sa2 appears in SCOPe 2.07